Protein Info for PP_0834 in Pseudomonas putida KT2440

Annotation: Sec translocation complex subunit YajC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 transmembrane" amino acids 24 to 41 (18 residues), see Phobius details TIGR00739: preprotein translocase, YajC subunit" amino acids 26 to 103 (78 residues), 96.5 bits, see alignment E=3.9e-32 PF02699: YajC" amino acids 26 to 100 (75 residues), 100.3 bits, see alignment E=2.4e-33

Best Hits

Swiss-Prot: 49% identical to YAJC_HAEIN: Sec translocon accessory complex subunit YajC (yajC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 98% identity to pen:PSEEN1001)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PL6 at UniProt or InterPro

Protein Sequence (111 amino acids)

>PP_0834 Sec translocation complex subunit YajC (Pseudomonas putida KT2440)
MSFFIPAAYADAAAPAAGPAGTGFEWIFLVGFLVIFYLMIWRPQAKRAKEQKNLLSNLQK
GDEVVTNGGIAGKIVKVSDDFVVLEVSDTVELKFQKGAIAATLPKGTLKAI