Protein Info for PP_0828 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details PF25539: Bestrophin_2" amino acids 29 to 283 (255 residues), 234.5 bits, see alignment E=1e-73

Best Hits

KEGG orthology group: K08994, putative membrane protein (inferred from 99% identity to ppf:Pput_0854)

Predicted SEED Role

"probable membrane protein STY1534"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PM2 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PP_0828 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MKDVIARKYRLVVKTIGYIGWSLFWLLIWDVLVTIDFMLFLNSKFTLPLIPLTLLGSALV
VLVSFRNSSAYSRWWEARTLWGALVNSSRSFARQTLTLIDDPDDGLNPVKATLLRRHIAY
VNCLAAHLKGESCPEELMAFIPPAEFERRNRSNNFANDILGGSAALLAREYQAGRLDSIR
LARLESTLVDLSNAQGGMERIANTPLPYPYVYFPRLFITLFCLIVPVGLVESLGWFTPLA
STVVGFMLLAIERIGTDLQSPFRFSEHQIQMDTICETIERNLESMQREAQCAEAVDA