Protein Info for PP_0827 in Pseudomonas putida KT2440

Annotation: putative phosphonate transport system permease protein PtxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 112 to 137 (26 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 5 to 252 (248 residues), 255.2 bits, see alignment E=3.1e-80 PF00528: BPD_transp_1" amino acids 82 to 252 (171 residues), 63.5 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 100% identity to ppu:PP_0827)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE1 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PM3 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PP_0827 putative phosphonate transport system permease protein PtxC (Pseudomonas putida KT2440)
MNRVINWVLLGAIVAAAVASFAYLQLDLHALVGNGGLGQMGEYAGRFLQPDLSAGHLKAV
WRGALETLAMSGMGTLLAMVLGMLLALPAAGRFGWPLQGAARLLLNALRAIPELVWAALT
VLAAGLGPNAGTLALALHTAGVLGRLFAEALENAPPEPAAAIRLQGGSQVAAFCFGTLPN
LWPQLLAYSLYRWENNIRMASVLGFVGAGGLGQMLYTTLSLFQEAQASTVIIGMLVLVLL
VDVSSDVLRQRYVRA