Protein Info for PP_0815 in Pseudomonas putida KT2440

Annotation: cytochrome bo terminal oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02847: cytochrome o ubiquinol oxidase subunit IV
  • amino acids 13 to 108 (96 residues), 122.8 bits, E=3.2e-40
• PF03626: COX4_pro
  • amino acids 20 to 93 (74 residues), 65.6 bits, E=2.2e-22

Best Hits

Swiss-Prot: 96% identical to CYOD_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Pseudomonas putida

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 99% identity to ppg:PputGB1_0852)

MetaCyc: 100% identical to cytochrome bo terminal oxidase subunit IV (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• proline to cytochrome bo oxidase electron transfer (1/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

See Q88PN4 at UniProt or InterPro

Protein Sequence (110 amino acids)

>PP_0815 cytochrome bo terminal oxidase subunit IV (Pseudomonas putida KT2440)
MANAHDTHHEGNHGSVKSYMIGFVLSIILTAIPFGLAMTASLPKNLTVLIIVAMAVIQVV
VHLVYFLHMDRSKEQRNNVSTFLFTTLVIALLVGLSLWIMFSIHFEMLAK