Protein Info for PP_0804 in Pseudomonas putida KT2440

Annotation: Protein secretion ABC efflux system, permease and ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 transmembrane" amino acids 179 to 201 (23 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 297 to 330 (34 residues), see Phobius details amino acids 407 to 434 (28 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 28 to 720 (693 residues), 842.7 bits, see alignment E=1.2e-257 PF00664: ABC_membrane" amino acids 180 to 445 (266 residues), 95.9 bits, see alignment E=5.2e-31 PF00005: ABC_tran" amino acids 512 to 657 (146 residues), 96.5 bits, see alignment E=3.2e-31

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to ppu:PP_0804)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PP4 at UniProt or InterPro

Protein Sequence (722 amino acids)

>PP_0804 Protein secretion ABC efflux system, permease and ATP-binding protein (Pseudomonas putida KT2440)
MSDSIDVTLPNQAPAPEQAAAHRPDLGPWLEVMLQVAHHYRLDVSPQRIRLAAAEDARPL
NEILRHMARQAGLALRFVHFDAKGLRQWRTPLVLELDDGQLAVVESVTEEDDLAVVFAGD
QGLTSRLPRDTLKGRISRVALLRPARPLRDVRTDDYTAPYDRHWFARIVLRDLRPYGQVM
IASLVANVLALAGVLFSMQVYDRVIPAESLPTLYVLFGGVVLALVFDFSMRLLRLKVTDL
LGKRADLRVSDLVYGHALRLRNSVRPKSTGSFISQLRELESIRDLITSSTATVLADLPFF
LLFLFVFWLIGGVLVFIPLVALLAMVLPGLLAQRRLARLANASMRESALRNAMLVESIQG
LDEIKALQAEARFERQWNQYNAACAHTNLRLRTLTNGLVTWTQNVQGAVFAVVIVIGAPM
VIAGDLTTGSLVAASMLSSRMMAPLAQLTHVLTRWQQAKVALQGLDKLMQSPVDHPEGEA
RVHLPAIHGEYRLRQANFRYSEDYPPVLNIGRLDIQPGERIAVLGRNGAGKSTLLQALGG
AMDLVQGEISLDGIAMAHLDPADLRRDVGLLPQYARLFHGTLRENLTLGAGQASDQELVA
ALAATGALDFVRRLPKGMDHLILEGGLGLSGGQRQALVLSRLLVRQPQVLLLDEPTASLD
DMTERKLLDNLERFCQGRTLVIATHRLSVLQRVDRILVLDAGRIVIDDARDAALAKLQGA
QA