Protein Info for PP_0803 in Pseudomonas putida KT2440

Annotation: Protein secretion ABC efflux system, membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 185 to 394 (210 residues), 220.8 bits, see alignment E=1.6e-69 PF26002: Beta-barrel_AprE" amino acids 280 to 372 (93 residues), 83.1 bits, see alignment E=1.8e-27

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 100% identity to ppf:Pput_0827)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PP5 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PP_0803 Protein secretion ABC efflux system, membrane fusion protein (Pseudomonas putida KT2440)
MSNHELPASYLDGQDDQAVFRAGRIITLCALMLAAFLAWAAWFEVTEVSTGTGKVIPSSR
EQVIQSFEGGIVAQMSVAEGDLVERGQVLAQLDPTKTASSVGESEAKYRAARASQARLQA
EVTGKPLTFPESLRDSPDLIDAETALYQTRRRGLEQTLAGIQDSLQLVRSELKITENLAK
MGASSRVEVIRLNRQRSELELKANEARSDYLVRAREELAKASAEADALSEVIRGRSDSLT
RLTLRSPVRGIVKDIEVNTLGGVVQPGGQVMKIVPMDERLLIETRIAPRDIAFIHPDQAA
KVKISAYDYSVYGGLDGKVVGISPDTLQDEVKPEIYYYRVFIRTEQDSLQNKAGKRFAIV
PGMIATVDIRTGEKTILDYLIKPLNRAKEALRER