Protein Info for PP_0795 in Pseudomonas putida KT2440

Annotation: fructose PTS permease - IIBC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 transmembrane" amino acids 243 to 269 (27 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 316 to 341 (26 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details amino acids 440 to 464 (25 residues), see Phobius details amino acids 476 to 496 (21 residues), see Phobius details amino acids 502 to 522 (21 residues), see Phobius details amino acids 543 to 564 (22 residues), see Phobius details PF02302: PTS_IIB" amino acids 5 to 92 (88 residues), 45.8 bits, see alignment E=8.1e-16 amino acids 121 to 210 (90 residues), 76.2 bits, see alignment E=2.5e-25 TIGR00829: PTS system, Fru family, IIB component" amino acids 121 to 204 (84 residues), 113.7 bits, see alignment E=3.8e-37 TIGR01427: PTS system, Fru family, IIC component" amino acids 227 to 565 (339 residues), 471.9 bits, see alignment E=1.5e-145 PF02378: PTS_EIIC" amino acids 246 to 509 (264 residues), 69.2 bits, see alignment E=3.5e-23

Best Hits

Swiss-Prot: 64% identical to PTFBC_ECOLI: PTS system fructose-specific EIIB'BC component (fruA) from Escherichia coli (strain K12)

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] K02770, PTS system, fructose-specific IIC component (inferred from 100% identity to ppu:PP_0795)

MetaCyc: 64% identical to fructose-specific PTS multiphosphoryl transfer protein FruA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PQ3 at UniProt or InterPro

Protein Sequence (580 amino acids)

>PP_0795 fructose PTS permease - IIBC component (Pseudomonas putida KT2440)
MNIAIVTACPNGQVSSVLSARLLSAAAQRRGWSTSVEVQNTEHPERQLSAAQIAEADWVL
VVSTGPVDLARFVGKRLYQSTPSQALADREGFLDEAAANAELLAAVTGAPAAASSAGARI
VAVTACPTGVAHTFMAAEALQQAAQQLGYQLTVETQGSVGARNPLSAEAIAAADVVLLAA
DIEVPTARFAGKRIYRCGTGIALKQARATLDKALAQATVENGADAAAATTPTKSEKTGVY
KHLLTGVSFMLPMVVAGGLLIALSFVFGIEAYKEAGTLPAALMQIGGEAAFKLMVPLLAG
YIAWSIADRPGLAPGMIGGLLASTLGAGFIGGIVAGFLAGYSAKAIARWARLPSSLEALK
PILIIPLLASLFTGLVMIYVVGQPVAAMLEGLTHFLDSMGTTNAILLGLLLGGMMCVDLG
GPINKAAYAFSVGLLASSSYAPMAATMAAGMVPPIGLGIATFLARRKFAQSEREAGKAAL
ALGLCFISEGAIPFAAKDPLRVIPASIAGGALTGALSMYFGCKLMAPHGGLFVLLIPNAI
NHALLYLLAIVAGSLVTAVVYAVIKKSERVELAVAPAKSV