Protein Info for PP_0794 in Pseudomonas putida KT2440

Annotation: 1-phosphofructokinase monomer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR03168: hexose kinase, 1-phosphofructokinase family" amino acids 4 to 307 (304 residues), 346 bits, see alignment E=1.5e-107 TIGR03828: 1-phosphofructokinase" amino acids 4 to 307 (304 residues), 345.9 bits, see alignment E=1.7e-107 PF00294: PfkB" amino acids 12 to 290 (279 residues), 173.1 bits, see alignment E=9.3e-55 PF08543: Phos_pyr_kin" amino acids 163 to 286 (124 residues), 29.2 bits, see alignment E=6e-11

Best Hits

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 100% identity to ppu:PP_0794)

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PQ4 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PP_0794 1-phosphofructokinase monomer (Pseudomonas putida KT2440)
MAKILTLTLNPALDITIGLDTLRPGQVNRSQAQHSHAAGKGLNVAQVLADLGHSVTVGGF
LGGDNLQPFEALIDGRGFTDCFVRVPGETRSNIKLVEADGRVTDINGQGPEVDEAARSAL
LHRLEQIAPGHDAVVVAGSLPRGISADWFRQLLERLKAQGLKVVLDSSGEALRVGLQSAP
WLVKPNTEELGEVLGLAVDNLTQQRAAAKRLLDSGVEHVVVSAGEQGVSWFSRDLALQAR
PPKVRVASTVGAGDSLVAGMVHGLLLAEAPAQTLTRATAIAAQAVTQVGFGIHDREHLAQ
LEAAVQLTEQQEGCR