Protein Info for PP_0786 in Pseudomonas putida KT2440

Annotation: thioredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01292: thioredoxin-disulfide reductase" amino acids 8 to 312 (305 residues), 401.4 bits, see alignment E=8.6e-125 PF07992: Pyr_redox_2" amino acids 8 to 300 (293 residues), 189 bits, see alignment E=4.5e-59 PF13738: Pyr_redox_3" amino acids 61 to 284 (224 residues), 70.3 bits, see alignment E=6.4e-23 PF00070: Pyr_redox" amino acids 149 to 224 (76 residues), 53.5 bits, see alignment E=1e-17

Best Hits

Swiss-Prot: 92% identical to GLCAL_PSEFL: Glucosaminate ammonia-lyase from Pseudomonas fluorescens

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 100% identity to ppu:PP_0786)

MetaCyc: 71% identical to thioredoxin reductase (Escherichia coli K-12 substr. MG1655)
Thioredoxin-disulfide reductase. [EC: 1.8.1.9]

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PR2 at UniProt or InterPro

Protein Sequence (320 amino acids)

>PP_0786 thioredoxin reductase (Pseudomonas putida KT2440)
MSEVRHSRVIILGSGPAGYSAAVYAARANLKPLLITGMQAGGQLTTTTEVDNWPGDPHGL
TGPALMQRMQEHAERFETEIVFDHINAVDLANKPFTLQGDSGKYTCDALIIATGASARYL
GLPSEETFMGKGVSACATCDGFFYRNKPVAVVGGGNTAVEEALYLANIASKVTLVHRRET
FRAEKILVDKLNARVAEGKIELKLNATLDEVLGDNMGVTGARLKNNDGSSDEIKVDGVFI
AIGHTPNTSLFEGQLTLKDGYLVVNGGREGNATATNVEGVFAAGDVADHVYRQAITSAGA
GCMAALDVERYLDGLANASF