Protein Info for PP_0778 in Pseudomonas putida KT2440

Annotation: Glycosyl transferase, group 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF13439: Glyco_transf_4" amino acids 19 to 183 (165 residues), 96.3 bits, see alignment E=4.4e-31 PF13579: Glyco_trans_4_4" amino acids 20 to 174 (155 residues), 65.8 bits, see alignment E=1.3e-21 PF00534: Glycos_transf_1" amino acids 195 to 357 (163 residues), 92.2 bits, see alignment E=5.5e-30 PF13692: Glyco_trans_1_4" amino acids 209 to 343 (135 residues), 105 bits, see alignment E=8.4e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0778)

Predicted SEED Role

"Glycosyl transferase, group 1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PS0 at UniProt or InterPro

Protein Sequence (396 amino acids)

>PP_0778 Glycosyl transferase, group 1 family protein (Pseudomonas putida KT2440)
MNTPALRITLVSETFPPEINGVANTLGRLSDGLRQRGHEVEVVRPRQAGEGHVHNDPQLM
LCRGWALPGYPGLQWGEVSMHKLLRRWRRQRPDVLYIATEGPLGLSALRAARRLGVAVVS
GFHTNFPQYSGQYGLGLLARLLTHYLRWFHRRTAITLVPSASQRLELERRGFERLELLAR
GVDACLFNPARRSQALRESWGLGPEDIAVLHVGRLAAEKNLGLLRPCFEALRKTYPQKRL
RLIMVGDGPQRTKLEQEIPDAVFCGAQRGERLAEHYASGDLFLFPSLTETFGNVVLEAMA
SGLAVVAYDEAAAAQHIRHGHSGALAMPGDQAAFVDAACWLLEEVETLRRVRLNARQHAS
RQGWPAIVEQFEGYLNSACRQPGATAGRSAQCLQRL