Protein Info for PP_0763 in Pseudomonas putida KT2440

Annotation: Medium-chain-fatty-acid CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 30 to 406 (377 residues), 259.3 bits, E=5.6e-81
• PF13193: AMP-binding_C
  • amino acids 457 to 536 (80 residues), 66.2 bits, E=4.2e-22

Best Hits

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 100% identity to ppu:PP_0763)

Predicted SEED Role

"Medium-chain-fatty-acid--CoA ligase (EC 6.2.1.-)" (EC 6.2.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Caprolactam degradation
• Ethylbenzene degradation
• Geraniol degradation
• Limonene and pinene degradation
• Propanoate metabolism
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

See Q88PT5 at UniProt or InterPro

Protein Sequence (560 amino acids)

>PP_0763 Medium-chain-fatty-acid CoA ligase (Pseudomonas putida KT2440)
MLQTRIIKPAEGAYAYPLLIKRLLMSGSRYEKTREIVYRDQMRLTYPQLNERIARLANVL
TEAGVKAGDTVAVMDWDSHRYLECMFAIPMIGAVVHTINVRLSPEQILYTMNHAEDRVVL
VNSDFVGLYQAIAGQLTTVDKTLLLTDGPDKTAELPGLVGEYEQLLAAASPRYDFPDFDE
NSVATTFYTTGTTGNPKGVYFSHRQLVLHTLAEASVTGSIDSVRLLGSNDVYMPITPMFH
VHAWGIPYAATMLGMKQVYPGRYEPDMLVKLWREEKVTFSHCVPTILQMLLNCPNAQGQD
FGGWKIIIGGSSLNRSLYQAALARGIQLTAAYGMSETCPLISAAHLNDELQAGSEDERVT
YRIKAGVPVPLVEAAIVDGEGNFLPADGETQGELVLRAPWLTMGYFKEPEKSEELWQGGW
LHTGDVATLDGMGYIDIRDRIKDVIKTGGEWVSSLDLEDLISRHPAVREVAVVGVADPQW
GERPFALLVARDGHDIDAKALKEHLKPFVEQGHINKWAIPSQIALVTEIPKTSVGKLDKK
RIRQDIVQWQASNSAFLSTL