Protein Info for PP_0761 in Pseudomonas putida KT2440

Annotation: Ribosomal RNA small subunit methyltransferase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF08468: MTS_N" amino acids 5 to 152 (148 residues), 154.5 bits, see alignment E=3.5e-49 PF05175: MTS" amino acids 162 to 328 (167 residues), 180.1 bits, see alignment E=4.5e-57 PF13649: Methyltransf_25" amino acids 196 to 292 (97 residues), 33.1 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 100% identical to RSMC_PSEPK: Ribosomal RNA small subunit methyltransferase C (rsmC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to ppu:PP_0761)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.172

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PT7 at UniProt or InterPro

Protein Sequence (332 amino acids)

>PP_0761 Ribosomal RNA small subunit methyltransferase C (Pseudomonas putida KT2440)
MDPRSEVLLRQAELFQGPLLIAGAPADDLLGQLPQAQAWTWHAGDQAMLESRFAGRSHYG
VEAPEAAFDSAVLFLPKSRELAAYLLNALASRLAGRELYLVGEKRGGIEGAAKQLQAFGK
PRKLDSARHCQLWQVTIDQAPQAKPLESLAERFELALEDGPLQVVSLPGVFSHGRLDRGT
ALLLKHLDGLPGGHMLDFGCGAGVLGATLKRRYPQSRVTLLDVDAFAVAASRLTLAANGL
EGEVISGDGIDAAPTELSLILSNPPFHTGVHTNYQASENLLKKSAVHLRKGGEMRLVANS
FLRYQPLIEGALGNCQVRDEADGFRIYQATRG