Protein Info for PP_0723 in Pseudomonas putida KT2440
Annotation: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ISPE_PSEPK: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 99% identity to ppf:Pput_0757)Predicted SEED Role
"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)
MetaCyc Pathways
- superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
- taxadiene biosynthesis (engineered) (11/13 steps found)
- methylerythritol phosphate pathway I (8/9 steps found)
- methylerythritol phosphate pathway II (8/9 steps found)
- isoprene biosynthesis I (8/10 steps found)
- superpathway of ergosterol biosynthesis II (10/26 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Terpenoid biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.148
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88PX5 at UniProt or InterPro
Protein Sequence (286 amino acids)
>PP_0723 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (Pseudomonas putida KT2440) MQKLTLPAPAKLNLWLHIIGRRADGYHELETVFQFLDHGDELSFALRDDGVIRLHTEIEA VPHDSNLIVRAARMLQAQSGTTLGADIWLTKVLPMGGGIGGGSSDAATTLLALAHLWQLD WDEDRLAALGLSLGADVPVFVRGHAAFAQGVGEQLTPVDPIEPWYVVLVPQVSVSTVEIF SHPQLTRDSLPLKMRPVPEGNSRNDCQPVVEQNYPEVRNALNSLGKFTEARLTGTGSCVF GAFPSKAEADKVLALLSATQTGFVAKGSNVSMLHRKLQSLVKKSSA