Protein Info for PP_0719 in Pseudomonas putida KT2440

Annotation: ribosome-associated potassium-dependent informational ATP/GTPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR00092: GTP-binding protein YchF" amino acids 1 to 366 (366 residues), 532.7 bits, see alignment E=2.5e-164 PF02421: FeoB_N" amino acids 5 to 45 (41 residues), 29.4 bits, see alignment 8.3e-11 PF01926: MMR_HSR1" amino acids 5 to 115 (111 residues), 72.7 bits, see alignment E=4e-24 PF06071: YchF-GTPase_C" amino acids 282 to 365 (84 residues), 139 bits, see alignment E=7e-45

Best Hits

Swiss-Prot: 74% identical to YCHF_HAEDU: Ribosome-binding ATPase YchF (ychF) from Haemophilus ducreyi (strain 35000HP / ATCC 700724)

KEGG orthology group: K06942, (no description) (inferred from 100% identity to ppg:PputGB1_0763)

MetaCyc: 71% identical to redox-responsive ATPase YchF (Escherichia coli K-12 substr. MG1655)
Nucleoside-triphosphatase. [EC: 3.6.1.15, 3.6.1.5]

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.15

Use Curated BLAST to search for 3.6.1.15 or 3.6.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PX9 at UniProt or InterPro

Protein Sequence (366 amino acids)

>PP_0719 ribosome-associated potassium-dependent informational ATP/GTPase (Pseudomonas putida KT2440)
MGFNCGIVGLPNVGKSTLFNALTKSGIAAENFPFCTIEPNSGIVPMPDARLAALAEIVKP
NRILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIAHVVRCFEDENVIHVSNSVD
PKRDIEIIDLELIFADLDSCEKQLQKVARNAKGGDKDALAQKAILEKLIPHFTEGKPARS
LMKHMADDEKAVIRGFHLLTSKPVMYIANVAEDGFDNNPHLDVVKAIAEEEGAVVVPVCN
KIEAEIAELEDGEEKDMFLEALGLEEPGLNRVIRAGYELLNLQTYFTAGVQEVRAWTVRV
GATAPQAAGVIHTDFEKGFIRAEVVAYDDFIQFKGEAGAKEAGKWRLEGKDYIVKDGDVM
HFRFNV