Protein Info for PP_0718 in Pseudomonas putida KT2440

Annotation: Sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 297 to 314 (18 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details amino acids 389 to 420 (32 residues), see Phobius details TIGR00815: sulfate permease" amino acids 16 to 556 (541 residues), 405.6 bits, see alignment E=1.6e-125 PF00916: Sulfate_transp" amino acids 28 to 392 (365 residues), 298.8 bits, see alignment E=5.1e-93 PF01740: STAS" amino acids 446 to 556 (111 residues), 60.4 bits, see alignment E=1.3e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0718)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PY0 at UniProt or InterPro

Protein Sequence (570 amino acids)

>PP_0718 Sulfate transporter (Pseudomonas putida KT2440)
MPQPTRFDWQRWLPGLVTLLHYKAAWLPKDIAAGLVLTTMLVPVGIAYAEASGVPGIYGL
YATIIPLLAYALFGPSRILVLGPDSALAAPILAVVVQYAASDPQRAIAIASMMALVAGAF
CVIAGLLRLGFITELLSKPIRYGYMNGIALTVLISQLPKLFGIKVDSEGPLRDLWYLGQA
LYAGQGHWPSFVVGAGSLALILLLKPFKRLPGILIAVVLATLAVSVFNLDQMGVKVLGQL
PQGLPGFVFPWVSDIDLVEVLLGGIAVALVSFADTSVLSRSYAARLKMRVNPNQEMFGLG
VANVASGLFQGIPISSSSSRTPVAEAAGSQTQLTGIIGALAVTLLLLVAPNLMQHLPNSA
LAAVVIAAALGLFEFADLKRIFRMQQWEFWLSFTCFVGVAVFGAIPGICIAVAVSVIEFL
WDGWRPHYAVLGRADGLRGYHDIQRYPQARRIPGLVLLRWDAPLFFANAEQFQNTVMAAV
DASPTPVQRVVIAAEPVTSIDITSADMLAELDRALEARGVELQFAEMKDPVKDKMRQFEL
FEHMGEKAFHPTVGAAVDAYLEESGVDWQP