Protein Info for PP_0716 in Pseudomonas putida KT2440

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 349 to 361 (13 residues), see Phobius details PF00529: CusB_dom_1" amino acids 24 to 337 (314 residues), 27.1 bits, see alignment E=8.1e-10 PF16576: HlyD_D23" amino acids 50 to 281 (232 residues), 57.8 bits, see alignment E=2.4e-19 PF13533: Biotin_lipoyl_2" amino acids 50 to 97 (48 residues), 50.8 bits, see alignment 2.8e-17 PF13437: HlyD_3" amino acids 207 to 285 (79 residues), 37.7 bits, see alignment E=7.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0716)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PY2 at UniProt or InterPro

Protein Sequence (365 amino acids)

>PP_0716 HlyD family secretion protein (Pseudomonas putida KT2440)
MSDATPTPPPSAPDRGIRWVLLLIAVSLLWYLLADRYTPYTQQARLQAYVVPVAAEVAGQ
IKRVAVGNNQEVRQGDVLFELDQEQYRIALARAEADLDTVRRQIGASTAGIDSAQAALVA
AQANERKARQDAERLKRLIDEDPGTVSVRRLEGAQATRDQAISQVAAARAEVERAREQQG
GAQEDNAQLRSAAANLEKARLDLARTVVRADANGLITDLRTDVGHYVGAGSPMMTLISIH
DVWISADMTENNLGRLRPETPVLVVLDALPGTVLKGRIRSIGYGVSVGQSTPPGTLPTVQ
NSREWLRSAQRFPVIIELERDQLQDKTVLRVGGQAEVMALPSEGNPLNLLGRLFMWLMSW
LSYAY