Protein Info for PP_0702 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 198 to 224 (27 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 232 (224 residues), 77.4 bits, see alignment E=1e-25 amino acids 204 to 366 (163 residues), 54.5 bits, see alignment E=9.2e-19 PF00083: Sugar_tr" amino acids 35 to 146 (112 residues), 41.6 bits, see alignment E=8.1e-15

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppg:PputGB1_0736)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PZ6 at UniProt or InterPro

Protein Sequence (385 amino acids)

>PP_0702 Major facilitator family transporter (Pseudomonas putida KT2440)
MNMRLLAGLLFAVSVVGFSLGASLPLVSLRLHEAGASTLEIGIISAIPAAGMMLSAFLVD
ACCRHLTRRTIYLLCFSLCTVSIALLESAFGSLWLLALLRLGLGLGMGIAIILGESWVNE
LCPEHNRGKIMALYATSFTGFQVLGPAMLAVLGADSPWITGVVTVCYGLALLCIVLTVPN
DHVEHEEGEKSFGLAGFFRVAPALCMAVLFFSFFDAVVLSLLPVYATSHGFAVGVAALMV
TVVFAGDMLFQLPLGWLADRVERTGLHLACGLVAMVIGIGLPWLLNLTWLLWPLLVVLGA
VAGGIYTLALVLIGQRFKGQDLVTANASVGLLWGVGSLVGPLVSGAAMNVAPHGLPMALA
LMAGLFVCFARQSYRRRGRMRAVAQ