Protein Info for PP_0701 in Pseudomonas putida KT2440

Annotation: fosmidomycin efflux system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 94 to 124 (31 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details amino acids 380 to 398 (19 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 245 (216 residues), 82 bits, see alignment E=2e-27 amino acids 233 to 399 (167 residues), 50.8 bits, see alignment E=6.4e-18

Best Hits

Swiss-Prot: 59% identical to FSR_ECOLI: Fosmidomycin resistance protein (fsr) from Escherichia coli (strain K12)

KEGG orthology group: K08223, MFS transporter, FSR family, fosmidomycin resistance protein (inferred from 100% identity to ppu:PP_0701)

MetaCyc: 59% identical to fosmidomycin efflux pump (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-41

Predicted SEED Role

"fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PZ7 at UniProt or InterPro

Protein Sequence (404 amino acids)

>PP_0701 fosmidomycin efflux system (Pseudomonas putida KT2440)
MATSSASTASTPAAASQASPMVMRIIGFCALAHLINDLIQSVLPAIYPMLKANYDLSFAQ
IGMITLTFQITASLLQPWVGFFTDRRPTPNLLPLGTLCTLVGIVMLAFVGSFPMILLASA
LVGIGSSTFHPETSRIARLASGGRFGLAQSTFQVGGNTGSALGPLLAAAIVIPFGQTHVA
WFGLAGLFFLGVTLMLRGWYKEHLNQAKARKAVQATHGISRNRVIAALIVLGLLVFSKYF
YMASFTSYFTFYLIEKFGVSVASSQLHLFLFLGAVAAGTFFGGPIGDRIGRKAVIWFSIL
GVAPFTLALPYADLFWTTVLSVVIGFILASAFSAIVVYAQELVPGSVGMIAGIFFGLMFG
FGGIGAALLGYVADLRGIEYVYGLCSFLPLFGLLAVLLPSTGKR