Protein Info for PP_0697 in Pseudomonas putida KT2440

Annotation: ribosomal-protein-S18-alanine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13527: Acetyltransf_9
  • amino acids 7 to 123 (117 residues), 25.7 bits, E=2.6e-09
• TIGR01575: ribosomal-protein-alanine acetyltransferase
  • amino acids 14 to 144 (131 residues), 143.7 bits, E=1.8e-46
• PF00583: Acetyltransf_1
  • amino acids 16 to 122 (107 residues), 54.3 bits, E=4.1e-18
• PF13673: Acetyltransf_10
  • amino acids 40 to 128 (89 residues), 49.7 bits, E=9.6e-17
• PF13508: Acetyltransf_7
  • amino acids 41 to 123 (83 residues), 47.7 bits, E=4.2e-16
• PF08445: FR47
  • amino acids 66 to 125 (60 residues), 37.7 bits, E=4e-13

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 98% identity to ppg:PputGB1_0729)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

See Q88Q01 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PP_0697 ribosomal-protein-S18-alanine N-acetyltransferase (Pseudomonas putida KT2440)
MSDSISFRPMTEADLDAVLKIEYAAFSHPWTRGIFQDALKSYEVWLMFDGQQQVGHGVIN
VIIDEAHLLNITVKPENQGCGLGLRLLKHLMARAYQLNGRECFLEVRASNQSAYRLYERY
GFNEIGRRRDYYPIAGGREDALVMACTLFED