Protein Info for PP_0682 in Pseudomonas putida KT2440

Annotation: conserved inner membrane protein of unknown function, UPF0114 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details TIGR00645: TIGR00645 family protein" amino acids 1 to 161 (161 residues), 237.7 bits, see alignment E=4.2e-75 PF03350: UPF0114" amino acids 9 to 125 (117 residues), 127.7 bits, see alignment E=1.3e-41

Best Hits

Swiss-Prot: 100% identical to Y713_PSEP1: UPF0114 protein Pput_0713 (Pput_0713) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: None (inferred from 98% identity to ppw:PputW619_4503)

Predicted SEED Role

"Putative inner membrane protein (Fragment)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q16 at UniProt or InterPro

Protein Sequence (162 amino acids)

>PP_0682 conserved inner membrane protein of unknown function, UPF0114 family (Pseudomonas putida KT2440)
MERILENAMYASRWLLAPIYFGLSLGLLALALKFFQEVVHVLPNVFALSEADLILVILSL
IDMSLVGGLLVMVMISGYENFVSQLDIDESKEKLNWLGKMDSSSLKMKVAASIVAISSIH
LLRVFMDAQNISTDYLMWYVIIHMTFVVSAFCMGYLDKLTKH