Protein Info for PP_0675 in Pseudomonas putida KT2440

Annotation: glutamate dehydrogenase, NADP-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF02812: ELFV_dehydrog_N" amino acids 58 to 185 (128 residues), 172.9 bits, see alignment E=2.4e-55 PF00208: ELFV_dehydrog" amino acids 203 to 447 (245 residues), 303.3 bits, see alignment E=1.4e-94

Best Hits

Swiss-Prot: 66% identical to DHE4_ECOLI: NADP-specific glutamate dehydrogenase (gdhA) from Escherichia coli (strain K12)

KEGG orthology group: K00262, glutamate dehydrogenase (NADP+) [EC: 1.4.1.4] (inferred from 100% identity to ppu:PP_0675)

MetaCyc: 66% identical to glutamate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glutamate dehydrogenase (NADP(+)). [EC: 1.4.1.4]

Predicted SEED Role

"NADP-specific glutamate dehydrogenase (EC 1.4.1.4)" in subsystem Arginine and Ornithine Degradation or Glutamate dehydrogenases or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Proline Synthesis (EC 1.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q23 at UniProt or InterPro

Protein Sequence (449 amino acids)

>PP_0675 glutamate dehydrogenase, NADP-dependent (Pseudomonas putida KT2440)
MSTMIESVDNFLARLKQRDPGQPEFHQAVEEVLRTLWPFLEANPHYLQSGILERMVEPER
AVLFRVSWVDDQGKVQVNRGYRIQMSSAIGPYKGGLRFHPSVNLSVLKFLAFEQVFKNSL
TSLPMGGGKGGSDFDPKGKSDAEVMRFCQAFMSELYRHIGADCDVPAGDIGVGAREIGFM
FGQYKRLANQFTSVLTGKGMTYGGSLIRPEATGYGCVYFAEEMLKRQDKRIDGRRVAVSG
SGNVAQYAARKVMDLGGKVISLSDSEGTLYAEAGLTDAQWDALMELKNVKRGRISELAGQ
FGLEFRKGQTPWSLPCDIALPCATQNELGAEDARTLLRNGCICVAEGANMPTTLEAVDIF
LDAGILYAPGKASNAGGVAVSGLEMSQNAMRLLWTAGEVDSKLHNIMQSIHHACVHYGEE
ADGRINYVKGANIAGFVKVADAMLAQGVV