Protein Info for PP_0669 in Pseudomonas putida KT2440

Annotation: Outer membrane ferric siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 810 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF07715: Plug" amino acids 157 to 258 (102 residues), 66.4 bits, see alignment E=3e-22 TIGR01783: TonB-dependent siderophore receptor" amino acids 159 to 810 (652 residues), 317.6 bits, see alignment E=9.9e-99 PF00593: TonB_dep_Rec_b-barrel" amino acids 349 to 778 (430 residues), 180.2 bits, see alignment E=1.4e-56

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ppu:PP_0669)

Predicted SEED Role

"Outer membrane ferripyoverdine receptor" in subsystem Siderophore Pyoverdine or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q29 at UniProt or InterPro

Protein Sequence (810 amino acids)

>PP_0669 Outer membrane ferric siderophore receptor (Pseudomonas putida KT2440)
MLLRDSASAHRHPLALAIFLALGGHVAVAEADSSAAAQRVVFDIPAGPLARQLNLLASQA
GLLIGGDAALTANKQSQAVHALSVDVALAQMLAGTGVAAVRTGEREFQLVSQAEDAAGAV
TLGATTISGQGLGAVTEATGAYATGRSSTATKLPMSLRETPQSVTVVTRQRMDDQNMKNL
DDVMRNATGVTIIKNGSERSLYQARGQTVDNLQIDGVPTNIGNPYSMDTISKPNTDIYDR
VEVVRGATGLMEGAGNPSASINLVRKRPTAERQALIETSVGSWDDYKTMVDLSAPLNEAG
TLRGRSVITYNNANSYLDTAQKENQLFYGIIEADLAESTLATFGFTYQKERNSGYDWSGL
PSKESGAFYPVSRSTSLTGDWNHLDKRNTTVFADIQHTFANGWKGVVAVNQMWAKSDFLG
NYTYPGGGPDLFTLNPRHFHFDDTQTSIDGYFTGPFQLLGRQHELIVGGNWNKDDFDYHG
GRDATYRYIVDMNNLAAFDPPKPTALNVNQWQYNRTQEQKGVYVASRFSLTDSTTFILGS
RLSWYSHDSLDDTNGVREPTDHKHFSKSGEVTPYAGLVQDLNENWSAYASYTEIFKPQSA
QDAEGTTLQPMTGSNYEIGLKGEFLDKRLQTAIALFQADQTGRAERVTCAQTWACYRASD
KVRNKGIELELTGEVLANWNVSAGYTYTQSKYIGGEQKGEDFNGASPRHLFKVATDYRLP
GALNQLRVGGSFYAQSKMTQTEVGEDYKIQQDAYHLTNLHAIYEINKRLEVQYNLDNVFD
KKYYQTLGNPNYWNFYGEPRNFNVALRARF