Protein Info for PP_0656 in Pseudomonas putida KT2440

Annotation: putative Amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 27 to 52 (26 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 103 to 129 (27 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 68 to 162 (95 residues), 91.5 bits, see alignment E=2e-30 PF00528: BPD_transp_1" amino acids 87 to 267 (181 residues), 89 bits, see alignment E=1.7e-29

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to ppu:PP_0656)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q42 at UniProt or InterPro

Protein Sequence (273 amino acids)

>PP_0656 putative Amino acid ABC transporter, permease protein (Pseudomonas putida KT2440)
MSTFPHSPKPVAKPAGAGLFGFRTRLLLTWLALFGLFVAFFLSFDLKFAIILEKFPNLAG
FKLGPNGFLQGAALTLFLCLCSMVVSVLLGFAAALARLSNSAVLVGVASFYTSFFRGTPL
LIQILLIYLGLPQVGLVPGAISAGIIALSLNYGAYLSEIFRAGILGVARGQREAALALGM
RTPQIFCHIILPQAMRVIIPPTANQFISMLKDSSLISVMGVWEVMFLAQSYGRSSYRYLE
MLTTAAVIYWVLSILLELLQARLERHFGKAYQR