Protein Info for PP_0625 in Pseudomonas putida KT2440

Annotation: Chaperone protein ClpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 854 PF02861: Clp_N" amino acids 5 to 127 (123 residues), 113.8 bits, see alignment E=4.6e-36 TIGR03346: ATP-dependent chaperone protein ClpB" amino acids 6 to 853 (848 residues), 1450.5 bits, see alignment E=0 PF00004: AAA" amino acids 203 to 335 (133 residues), 49.9 bits, see alignment E=3.3e-16 amino acids 602 to 720 (119 residues), 35.9 bits, see alignment E=6.9e-12 PF17871: AAA_lid_9" amino acids 342 to 444 (103 residues), 120.4 bits, see alignment E=2.1e-38 PF07724: AAA_2" amino acids 596 to 758 (163 residues), 236.3 bits, see alignment E=1.3e-73 PF00158: Sigma54_activat" amino acids 599 to 709 (111 residues), 23.5 bits, see alignment E=2.9e-08 PF07728: AAA_5" amino acids 601 to 722 (122 residues), 49.6 bits, see alignment E=3.1e-16 PF10431: ClpB_D2-small" amino acids 764 to 843 (80 residues), 87.3 bits, see alignment E=4e-28

Best Hits

Swiss-Prot: 100% identical to CLPB_PSEPK: Chaperone protein ClpB (clpB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03695, ATP-dependent Clp protease ATP-binding subunit ClpB (inferred from 73% identity to abo:ABO_0479)

MetaCyc: 70% identical to protein disaggregase ClpB (Escherichia coli K-12 substr. MG1655)
RXN185E-10

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q71 at UniProt or InterPro

Protein Sequence (854 amino acids)

>PP_0625 Chaperone protein ClpB (Pseudomonas putida KT2440)
MRIDRLTSKLQLAISDAQSLAVGMDHPAIEPVHLLQALLEQQGGSIKPLLMQVGFDINGL
RQGLVKELDQLPKIQNPTGDVNMSQDLARLLNQADRLAQQKGDQFISSELVLLAAMDENS
KLGKLLLSQGVSKKALENAINNLRGGAAVNDANAEESRQALDKYTVDLTKRAEEGKLDPV
IGRDDEIRRTVQVLQRRTKNNPVLIGEPGVGKTAIAEGLAQRIINGEVPDGLKGKRLLAL
DMGALIAGAKYRGEFEERLKSLLNELSKQEGQIILFIDELHTMVGAGKGEGAMDAGNMLK
PALARGELHCVGATTLNEYRQFIEKDAALERRFQKVLVEEPSEEDTIAILRGLKERYEVH
HKVAITDGAIIAAAKLSHRYITDRQLPDKAIDLIDEAASRIRMEIDSKPEVLDRLDRRLI
QLKVESQALKKEEDEAAKKRLEKLTEEIERLEREYSDLEEIWASEKAEVQGSAQIQQKIE
QSRQELEAARRKGDLNRMAELQYGVIPDLERSLQMVDQHGKTDNQLLRNKVTEEEIAEVV
SKWTGIPVAKMLEGEREKLLKMEELLHQRVIGQSEAVTAVANAVRRSRAGLSDPNRPSGS
FLFLGPTGVGKTELCKALAEFLFDTEEAMVRIDMSEFMEKHSVARLIGAPPGYVGYEEGG
YLTEAVRRKPYSVVLLDEVEKAHPDVFNVLLQVLEDGRLTDSHGRTVDFRNTVIVMTSNL
GSAQIQELVGDREAQRAAVMDAVGAHFRPEFINRIDEVVVFEPLGREQIAGITEIQLGRL
RSRLLERELSLSLSPEALDKLIAVGYDPVYGARPLKRAIQRWIENPLAQLILAGKFLPGT
AITAKVEGDEIVFG