Protein Info for PP_0622 in Pseudomonas putida KT2440

Annotation: Outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 5 to 245 (241 residues), 281.1 bits, see alignment E=3.6e-88 PF13512: TPR_18" amino acids 22 to 166 (145 residues), 168.4 bits, see alignment E=1.1e-53 PF13525: YfiO" amino acids 30 to 233 (204 residues), 254.8 bits, see alignment E=6.1e-80

Best Hits

Swiss-Prot: 77% identical to BAMD_PSEAE: Outer membrane protein assembly factor BamD (bamD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05807, putative lipoprotein (inferred from 99% identity to ppf:Pput_0662)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q73 at UniProt or InterPro

Protein Sequence (339 amino acids)

>PP_0622 Outer membrane protein assembly factor BamD (Pseudomonas putida KT2440)
MRVKHLLLIAILGLTAACSSNKEVIDENLSEAELYQQAQADLDNSSYTSAVNKLKALESR
YPFGRYADQAQLELIYANYKNSEPEAAKSAAERFIRLHPQHPNVDYAYYLKGLTSFDQDR
GLLARFLPLDMTKRDPGAARDSYNEFAQLTSRFPNSRYAPDAKQRMIYLRNLLASYEIHV
ADYYLSRQAYVAAANRGRYVVENFQETPSVGDGLAVMVESYQKLHLDELAATSLETLKLN
YPDHPSLVDGEFQPKQTESDGRGWLSKATLGLIETETPLPPGETRANQDVVKQFQDARDE
MPRELLPKDENGDPIVPEGPKEAEKDRSWFSYMTFGLFD