Protein Info for PP_0617 in Pseudomonas putida KT2440

Annotation: Branched-chain amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 36 to 303 (268 residues), 139.5 bits, see alignment E=6.2e-45

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to ppf:Pput_0657)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q78 at UniProt or InterPro

Protein Sequence (339 amino acids)

>PP_0617 Branched-chain amino acid ABC transporter, permease protein (Pseudomonas putida KT2440)
MSEKNPLPVAKGRAPALLSLVVASLVALPLLLPSATLATEILIFAMAALACNLLLGYTGL
LSFGQGIFFGVGAYGAALLMIHLQWGMFAALLGAAVFGAFLALLVGALAIRRTGIYFVML
TLAFSQMAYFLAYTLSGWTGGDNGLLDVPRPNIEIAGHVLVDLADPRHFYVFVAVLFLLI
FAAALRVIRSPFGSTLLAIRENETRAAAIGYDTRHFKILVFMLSGAITGIAGALYAMLLH
FAPLSNIDLMMSENILIMTIVGGTGSLFGSLLGAGAIVLLGDVLSELWPRWLMLLGVILI
LVVVFMRGGLWGGLTELGKRLLATRNADDKPQAKTKETL