Protein Info for PP_0612 in Pseudomonas putida KT2440

Annotation: FAD-dependent glycine/D-amino acid oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01266: DAO" amino acids 5 to 345 (341 residues), 240.7 bits, see alignment E=3.6e-75 PF00890: FAD_binding_2" amino acids 5 to 212 (208 residues), 32 bits, see alignment E=8.3e-12 TIGR02352: glycine oxidase ThiO" amino acids 5 to 348 (344 residues), 261.2 bits, see alignment E=7.1e-82

Best Hits

Swiss-Prot: 100% identical to GLYOX_PSEPK: Glycine oxidase (thiO) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03153, glycine oxidase [EC: 1.4.3.19] (inferred from 100% identity to ppu:PP_0612)

Predicted SEED Role

"Glycine oxidase ThiO (EC 1.4.3.19) / Opine oxidase subunit B" in subsystem Thiamin biosynthesis (EC 1.4.3.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q83 at UniProt or InterPro

Protein Sequence (365 amino acids)

>PP_0612 FAD-dependent glycine/D-amino acid oxidase (Pseudomonas putida KT2440)
MSKQVVVVGGGVIGLLTAFNLAAKVGQVVVCDQGEVGRESSWAGGGIVSPLYPWRYSPAV
TALAHWSQDFYPQLGERLFASTGVDPEVHTTGLYWLDLDDEAEALAWAAREQRPLSAVDI
SAAYDAVPVLGPGFKHAIYMAGVANVRNPRLVKSLKAALLALPNVSLREHCQITGFVQEK
GRVTGVQTADGVLAADEVVLSAGAWSGDLLRTLGLELPVEPVKGQMILFKCAEDFLPSMV
LAKGRYAIPRRDGHILVGSTLEHAGYDKTPTADALESLKASAVELLPELEGATVVAHWAG
LRPGSPEGIPYIGPVPGHEGLWLNCGHYRNGLVLAPASCQLFTDLLTGAEPIIDPAPYAP
EGRLG