Protein Info for PP_0604 in Pseudomonas putida KT2440

Annotation: Lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to LSPA_PSEPK: Lipoprotein signal peptidase (lspA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to ppu:PP_0604)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q91 at UniProt or InterPro

Protein Sequence (176 amino acids)

>PP_0604 Lipoprotein signal peptidase (Pseudomonas putida KT2440)
MRCATMPNPAAGRFGRLAWLWLSLLVLVIDQATKLYFNNALTMYQQIVVIPDYFSWTLAY
NTGAAFSFLADGAGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAVALALVLGGAIGNL
YDRIVLGHVVDFILVHWQNRHYFPAFNVADSAITVGAVMLALDMFKSKKSEDPVHD