Protein Info for PP_0598 in Pseudomonas putida KT2440

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 60 to 82 (23 residues), see Phobius details amino acids 106 to 133 (28 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details PF04403: PqiA" amino acids 57 to 210 (154 residues), 158.4 bits, see alignment E=6.8e-51

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 99% identity to ppf:Pput_0638)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FVZ4 at UniProt or InterPro

Protein Sequence (219 amino acids)

>PP_0598 paraquat-inducible protein A (Pseudomonas putida KT2440)
MSNSVEPETLAQLPLDELVACHECDLLLRKPVLQHDEKAQCPRCGYELYAHRHNVVNRSL
ALVLTALLLFVPANFLPIMQLHLLGQTSDDTVWSGVLGLYNSGMRGVAVVVLLCSMVIPL
AKLLCQLAVLLSIRLNFGRDYGLVFYRIYHHLRDWGMLEVYFMGVLVAIVKLVDLAELTV
GLGLFCFISLLLIQVWLEVVMSPHQIWSALSGEDLHAGD