Protein Info for PP_0553 in Pseudomonas putida KT2440

Annotation: Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 6 to 77 (72 residues), 52.3 bits, E=8.4e-18
• PF00561: Abhydrolase_1
  • amino acids 134 to 353 (220 residues), 110 bits, E=3.2e-35
• PF12146: Hydrolase_4
  • amino acids 135 to 347 (213 residues), 42 bits, E=1.4e-14
• PF12697: Abhydrolase_6
  • amino acids 135 to 359 (225 residues), 89.1 bits, E=1.4e-28

Best Hits

Swiss-Prot: 95% identical to ACOC_PSEPU: Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system (acoC) from Pseudomonas putida

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 100% identity to ppu:PP_0553)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex (EC 2.3.1.-)" in subsystem Acetoin, butanediol metabolism (EC 2.3.1.-)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Citrate cycle (TCA cycle)
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycolysis / Gluconeogenesis
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Pyruvate metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.12

Use Curated BLAST to search for 2.3.1.- or 2.3.1.12

Sequence Analysis Tools

See Q88QE1 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PP_0553 Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system (Pseudomonas putida KT2440)
MSQIHTLTMPKWGLSMTEGRVDTWLKQEGDEISKGDEVLDVETDKISSSVEAPFSGVLRR
QVAKPDETLPVGALLAVVVEGEAEEAEIDAVVQRFQAEFVAEGGADQSQGPAPQKAEVGG
RLLRWFELGEGGTPLVLVHGFGGDLNNWLFNHPALAAERRVIALDLPGHGESAKALQRGD
LDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARLAPQRVASLSLVASAGLGEAING
QYLQGFVTAANRNALKPQMVQLFADPALVTRQMLEDMLKFKRLEGVDQALQQLAGALADG
DRQRHDLRGVLGNHPALVVWGGKDAIIPASHAEGLEAEVQVLPEAGHMVQMEAAEQVNQQ
LLAFLRKH