Protein Info for PP_0551 in Pseudomonas putida KT2440

Annotation: MORN domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 PF02493: MORN" amino acids 100 to 121 (22 residues), 15.8 bits, see alignment (E = 1e-06) amino acids 123 to 144 (22 residues), 12.6 bits, see alignment (E = 1.1e-05) amino acids 146 to 159 (14 residues), 7.3 bits, see alignment (E = 0.00053) amino acids 168 to 187 (20 residues), 15.6 bits, see alignment (E = 1.2e-06) amino acids 190 to 212 (23 residues), 14.3 bits, see alignment (E = 3.1e-06) amino acids 213 to 234 (22 residues), 13 bits, see alignment (E = 8.1e-06) amino acids 236 to 256 (21 residues), 15 bits, see alignment (E = 2e-06) amino acids 259 to 281 (23 residues), 19.7 bits, see alignment (E = 6.1e-08) amino acids 328 to 348 (21 residues), 15.6 bits, see alignment (E = 1.3e-06) PF01650: Peptidase_C13" amino acids 401 to 451 (51 residues), 25.2 bits, see alignment 1.1e-09 amino acids 465 to 604 (140 residues), 125 bits, see alignment E=4e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0551)

Predicted SEED Role

"MORN repeat family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QE3 at UniProt or InterPro

Protein Sequence (642 amino acids)

>PP_0551 MORN domain protein (Pseudomonas putida KT2440)
MAPVGAGGPANNATWWRTPALPVFAAEAAPTGYWQGSKAVRWHRGSLSQDPILRHTRQTY
CPVLAMRPLLPITLVLLLAACGDGESLLPPDARLPDGGRYRGQVVDGLLQGEGRIDYPNG
SWYAGSFKDGQWHGQGEWHGQNGEVYRGQFAEGLFQGLGDLITPGSHYSGTFRHGRRDGE
GTLKQADQTYRGQFKDDLYDGAGQLELADGSRYQGLFAKGKPNGAGVRSDASGNQFSGHF
VNGQLQGAGTYDSVDGEQYIGEFKDNRLEGRGRYENADGDVWIGEFKDGSLIGEGELLGS
DGSHYKGEFADWRLSGQGSLQLADGSKYIGGFLNDAYHGHGRLILPSGKVESGTWANGVR
VRDQNGKLLPDPLDLALLNQGRLLDEALVRVPRSAPPIQLYSLVVAGDGQQSVFLREADY
VSRMLKVRFGARGQVTLVNHRDHMATRPMATRENLSRAAATLAERSGPEDLVFIYLTSHG
SQDHQLVLDQPRLQLADLAADELATALAPLKDRDKVIVISACYSGGYIAPLKDERTLIMT
AARADRVSFGCSEEADFTYFGDALFAEALNQTDDLKQAFELARASVAEREQREGFEASEP
QLWAPPAVLEHWHQLRQQQAEEALRNATQANVSKQAKMPGTH