Protein Info for PP_0544 in Pseudomonas putida KT2440

Annotation: Ethanolamine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 110 to 135 (26 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details amino acids 352 to 369 (18 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details amino acids 439 to 457 (19 residues), see Phobius details TIGR00908: ethanolamine permease" amino acids 26 to 470 (445 residues), 677.5 bits, see alignment E=4.4e-208 PF00324: AA_permease" amino acids 51 to 442 (392 residues), 112.5 bits, see alignment E=2.2e-36 PF13520: AA_permease_2" amino acids 68 to 452 (385 residues), 149.8 bits, see alignment E=1.2e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0544)

Predicted SEED Role

"Ethanolamine permease" in subsystem Ethanolamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QF0 at UniProt or InterPro

Protein Sequence (482 amino acids)

>PP_0544 Ethanolamine transporter (Pseudomonas putida KT2440)
MPSEHSAGSPAGSSVDFEKVGSDYFQQRELKKGAAGWVLLVGLGVAYVISGDYAGWNFGL
AQGGWGGMFLATLLMATMYLCMCFSLAELSSMIPTAGGGYGFARSAFGPWGGFLTGTAIL
IEYAIAPAAIAVFIGAYCQSLFGIGGWMIYLAFYIVFISIHIFGVGEALKLMFIITAIAA
IALAVFLIGMVPHFDAANLFDIAKTDAVGASSFLPFGYVGVWAAIPYAIWFFLAVEGVPL
AAEETKNPKRDLPRGLIGAMLVLLAFALLILVVGPGGAGSEALKASGNPLVEALSKAYGG
STWMGGFVNLVGLAGLIASFFSIIYAYSRQIFALSRAGYLPRKLSETNKSKAPVLALVIP
GIIGFALSLTGQGDLLILVAVFGATLSYVLMMAAHITLRIRRPKMERPYRTPGGIFTSGL
ALVLACIAVVAGFLVDPRVVIGAAVIYAVLIAYFAFYSRHHLVAGTPEEEFAAIQKAEEA
LH