Protein Info for PP_0529 in Pseudomonas putida KT2440

Annotation: Exodeoxyribonuclease 7 small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 TIGR01280: exodeoxyribonuclease VII, small subunit" amino acids 9 to 64 (56 residues), 75.6 bits, see alignment E=1.2e-25 PF02609: Exonuc_VII_S" amino acids 10 to 61 (52 residues), 72.5 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 100% identical to EX7S_PSEP1: Exodeoxyribonuclease 7 small subunit (xseB) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 99% identity to ppg:PputGB1_0574)

MetaCyc: 44% identical to exodeoxyribonuclease VII subunit XseB (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QG5 at UniProt or InterPro

Protein Sequence (80 amino acids)

>PP_0529 Exodeoxyribonuclease 7 small subunit (Pseudomonas putida KT2440)
MARKKASLDFEQSLADLQALVERLENGELSLEESLAAFEQGIALTRDCQGALAQAEQKVQ
ILLERDGELAAQPFDAEPEA