Protein Info for PP_0522 in Pseudomonas putida KT2440

Annotation: GTP cyclohydrolase-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR00505: GTP cyclohydrolase II" amino acids 7 to 194 (188 residues), 262.2 bits, see alignment E=1.1e-82 PF00925: GTP_cyclohydro2" amino acids 8 to 170 (163 residues), 220.6 bits, see alignment E=4.9e-70

Best Hits

Swiss-Prot: 100% identical to RIBA_PSEPK: GTP cyclohydrolase-2 (ribA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01497, GTP cyclohydrolase II [EC: 3.5.4.25] (inferred from 98% identity to ppw:PputW619_0575)

MetaCyc: 65% identical to GTP cyclohydrolase 2 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

"GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QH1 at UniProt or InterPro

Protein Sequence (205 amino acids)

>PP_0522 GTP cyclohydrolase-2 (Pseudomonas putida KT2440)
MPVVFVAASKLPTPFATFTMHGFLDEATGREHVVLSLGDIADGQPVLGRLHSECLTGDAL
FSQRCDCGSQLEAALQAIAREGRGVLLYLRQEGRGIGLLNKIRAYELQDGGADTVEANER
LGFAADQRDYAICLPMLEHLGVKSLRLMTNNPRKVKALTDMNIVVAERVPLHTGHNPHNR
YYLATKAGKLGHMLGNEHQGEVPQA