Protein Info for PP_0513 in Pseudomonas putida KT2440

Annotation: DNA-binding transcriptional repressor NrdR-Zn2+-ATP/dATP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR00244: transcriptional regulator NrdR" amino acids 6 to 152 (147 residues), 235.9 bits, see alignment E=8.2e-75 PF03477: ATP-cone" amino acids 57 to 141 (85 residues), 70.8 bits, see alignment E=5.8e-24

Best Hits

Swiss-Prot: 100% identical to NRDR_PSEPK: Transcriptional repressor NrdR (nrdR) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 99% identity to pen:PSEEN0587)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QI0 at UniProt or InterPro

Protein Sequence (159 amino acids)

>PP_0513 DNA-binding transcriptional repressor NrdR-Zn2+-ATP/dATP (Pseudomonas putida KT2440)
MLPATMHCPFCGANDTKVIDSRLVAEGEQVRRRRECVACGERFTTFETAELVLPRLIKQD
GTRQPFDEEKLRAGMQRALEKRPVSVERLEAALAHIKSRLRATGEREVKSLVVGEMVMAE
LRKLDEVAYIRFASVYRRFQDLDEFREEIDRLAREPAKE