Protein Info for PP_0510 in Pseudomonas putida KT2440

Annotation: Thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF00085: Thioredoxin" amino acids 11 to 109 (99 residues), 95 bits, see alignment E=6.4e-31 TIGR01068: thioredoxin" amino acids 12 to 111 (100 residues), 102.6 bits, see alignment E=5.6e-34 PF13098: Thioredoxin_2" amino acids 26 to 110 (85 residues), 40.8 bits, see alignment E=6.2e-14 PF14559: TPR_19" amino acids 130 to 196 (67 residues), 41.4 bits, see alignment E=3.8e-14 PF14561: TPR_20" amino acids 201 to 290 (90 residues), 95.5 bits, see alignment E=4.8e-31

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 100% identity to ppu:PP_0510)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QI2 at UniProt or InterPro

Protein Sequence (290 amino acids)

>PP_0510 Thioredoxin (Pseudomonas putida KT2440)
MTQDTPYIFDATDTNFQQLVIENSFHKPVLVDFWAEWCAPCKALMPLLAKIAEGYQGELL
LAKINCDVEQQVVAQFGIRSLPTVVLFKDGQPVDGFAGAQPESAIRAMLEPHVQMPAAPT
AAPLEQAKALFAESRFAETETLLQALLGEDNSNAEALILYARCLAERGELGEAQVVLDAV
KTDEHKAALAGAKAQLTFLRQAASLPEVADLKSRLAQNPQDDEAAYQLSIQQLARQQYEA
ALEGLLKLFQRNRGYENGLPQKALLQVFELLGGDHPLVGVYRRKLSAAMF