Protein Info for PP_0491 in Pseudomonas putida KT2440

Annotation: formate dehydrogenase-O, gamma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details TIGR01583: formate dehydrogenase, gamma subunit" amino acids 7 to 205 (199 residues), 199.3 bits, see alignment E=3.4e-63 PF01292: Ni_hydr_CYTB" amino acids 9 to 186 (178 residues), 81.9 bits, see alignment E=5.3e-27 PF14358: DUF4405" amino acids 116 to 175 (60 residues), 30.7 bits, see alignment E=3.8e-11

Best Hits

Swiss-Prot: 48% identical to FDOI_ECOLI: Formate dehydrogenase, cytochrome b556(fdo) subunit (fdoI) from Escherichia coli (strain K12)

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 100% identity to ppf:Pput_0525)

MetaCyc: 48% identical to formate dehydrogenase O subunit gamma (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QK0 at UniProt or InterPro

Protein Sequence (218 amino acids)

>PP_0491 formate dehydrogenase-O, gamma subunit (Pseudomonas putida KT2440)
MNDNKPILRYNANERSNHWAVAILFILAGLSGLALFHPALFWLSNLFGGGPWTRILHPFI
GVAMFVFFLGLVLRFWRANFITANDRLWLRRVDRVMRNEEEGVPPIGKYNAGQKLLFWTL
LVCMLVLLVSGVVIWRAYFSHWFGIDAIRLSALLHALAAFVLILSIIVHIYAGIWIKGSI
GAMLHGWVSRAWARKHHELWYREVTGDKTPGDHGRKEG