Protein Info for PP_0488 in Pseudomonas putida KT2440

Annotation: putative NADP-dependent dehydrogenase HI_1430

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00106: adh_short" amino acids 2 to 186 (185 residues), 178.4 bits, see alignment E=2.3e-56 PF08659: KR" amino acids 4 to 163 (160 residues), 41.6 bits, see alignment E=2.6e-14 PF01370: Epimerase" amino acids 5 to 171 (167 residues), 31.3 bits, see alignment E=2.9e-11 PF13561: adh_short_C2" amino acids 8 to 223 (216 residues), 111.6 bits, see alignment E=9.1e-36

Best Hits

Swiss-Prot: 57% identical to Y1430_HAEIN: Probable NADP-dependent dehydrogenase HI_1430 (HI_1430) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0488)

MetaCyc: 53% identical to 3-hydroxy acid dehydrogenase YdfG (Escherichia coli K-12 substr. MG1655)
RXN-16000 [EC: 1.1.1.381]; RXN-8974 [EC: 1.1.1.381, 1.1.1.298]; Serine 3-dehydrogenase. [EC: 1.1.1.381, 1.1.1.298, 1.1.1.276]

Predicted SEED Role

"Short chain dehydrogenase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.276 or 1.1.1.298 or 1.1.1.381

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QK2 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PP_0488 putative NADP-dependent dehydrogenase HI_1430 (Pseudomonas putida KT2440)
MKTAFVTGASSGFGRAICCTLIGKGYRVIGGARRMDKLKALEAELGVNFIPLALDVTDSV
SLDKAVEQMREASLQIDLLVNNAGLALGVDRAQTSSAANWQQMIDTNITGLAMVTHKILP
QMVEADSGMIINIGSIAGTYPYPGGNVYGASKAFVRQFSLNLRADLAGTRVRVSNIEPGL
CSGTDFSVVRLNGDMDAVQALYRDVEALLPEDIAATVAWVAEQPAHVNINTIEIMPVAQS
SAALNVVRNLPRA