Protein Info for PP_0462 in Pseudomonas putida KT2440

Annotation: 50S ribosomal subunit protein L29

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 64 PF00831: Ribosomal_L29" amino acids 5 to 60 (56 residues), 79.8 bits, see alignment E=6.1e-27 TIGR00012: ribosomal protein uL29" amino acids 6 to 61 (56 residues), 72.6 bits, see alignment E=1e-24

Best Hits

Swiss-Prot: 100% identical to RL29_PSEPW: 50S ribosomal protein L29 (rpmC) from Pseudomonas putida (strain W619)

KEGG orthology group: K02904, large subunit ribosomal protein L29 (inferred from 94% identity to pmy:Pmen_3901)

MetaCyc: 73% identical to 50S ribosomal subunit protein L29 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L29p (L35e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QM7 at UniProt or InterPro

Protein Sequence (64 amino acids)

>PP_0462 50S ribosomal subunit protein L29 (Pseudomonas putida KT2440)
MMKANELREKSAQQLNEQLLGLLRDQFNLRMQKATGQLGQSHLLSQVKRDIARVKTVLNQ
QAGK