Protein Info for PP_0458 in Pseudomonas putida KT2440

Annotation: 30S ribosomal protein S19

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 TIGR01050: ribosomal protein uS19" amino acids 1 to 91 (91 residues), 146 bits, see alignment E=1.6e-47 PF00203: Ribosomal_S19" amino acids 3 to 83 (81 residues), 125.2 bits, see alignment E=3.7e-41

Best Hits

Swiss-Prot: 100% identical to RS19_PSEPG: 30S ribosomal protein S19 (rpsS) from Pseudomonas putida (strain GB-1)

KEGG orthology group: K02965, small subunit ribosomal protein S19 (inferred from 96% identity to psa:PST_0788)

MetaCyc: 81% identical to 30S ribosomal subunit protein S19 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S19p (S15e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QN1 at UniProt or InterPro

Protein Sequence (91 amino acids)

>PP_0458 30S ribosomal protein S19 (Pseudomonas putida KT2440)
MPRSLKKGPFIDLHLLKKVEVAVEKNDRKPVKTWSRRSMILPQMVGLTIAVHNGRQHVPV
LVNEDMVGHKLGEFAGTRTYRGHVADKKAKR