Protein Info for PP_0451 in Pseudomonas putida KT2440

Annotation: Elongation factor G 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 715 TIGR00484: translation elongation factor G" amino acids 1 to 714 (714 residues), 1150.2 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 9 to 287 (279 residues), 210.3 bits, see alignment E=5.9e-66 TIGR00231: small GTP-binding protein domain" amino acids 10 to 187 (178 residues), 111.9 bits, see alignment E=2.8e-36 PF22042: EF-G_D2" amino acids 325 to 408 (84 residues), 66.1 bits, see alignment E=7.6e-22 PF03144: GTP_EFTU_D2" amino acids 340 to 407 (68 residues), 72.1 bits, see alignment E=1.3e-23 PF14492: EFG_III" amino acids 420 to 494 (75 residues), 118.6 bits, see alignment E=2.9e-38 PF03764: EFG_IV" amino acids 495 to 620 (126 residues), 136.2 bits, see alignment E=1.5e-43 PF00679: EFG_C" amino acids 624 to 708 (85 residues), 102 bits, see alignment E=4.6e-33

Best Hits

Swiss-Prot: 100% identical to EFG1_PSEPK: Elongation factor G 1 (fusA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to ppu:PP_0451)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QN8 at UniProt or InterPro

Protein Sequence (715 amino acids)

>PP_0451 Elongation factor G 1 (Pseudomonas putida KT2440)
MARTTAINRYRNIGICAHVDAGKTTTTERILFYTGLSHKMGEVHDGAATTDWMVQEQERG
ITITSAAVTTFWKGSRGQYDNYRVNVIDTPGHVDFTIEVERSLRVLDGAVVVFCGTSGVE
PQSETVWRQANKYGVPRVVYVNKMDRAGANFLRVVGQIKNRLGHTPVPVQLAIGSEDNFQ
GQVDLIKMKAIYWNDDDKGTTYREEEIPADMVELANEWRNNMVEAAAEATEELMNKYLEE
GELSVEEIKAGLRARTLASEIVPAVCGSSFKNKGVPLVLDAVIDFLPAPTEIPAIKGIHP
DLIDVPKDEVKPEQFDERHADDDEPFSALAFKIATDPFVGTLTFVRVYSGFLTSGDSVIN
SVKGKKERVGRMVQMHANQREEIKEVRAGDIAALIGMKDVTTGDTLCNADKPIILERMDF
PEPVISLSVEPKTKQDQEKMGIALGKLAQEDPSFRVKTDEETGQTIISGMGELHLDILVD
RMKREFNVEANIGKPQVSYREKITKSNVEIEGKFVRQSGGRGQFGHCWVRFSEPDVDDKG
NITEGLVFSNEVVGGVIPKEYIPAIQKGIEEQMKNGVVAGYPLIGLKAAVFDGSYHDVDS
NEMAFKIAASMATKQLAQKGGGVVLEPIMKVEVVTPEDYLGDVMGDLNRRRGLVQGMDES
VSGRVVRAEVPLGEMFGYATDVRSMSQGRASYSMEFSKYAEAPSNIVEALVKKQG