Protein Info for PP_0436 in Pseudomonas putida KT2440

Annotation: Tyrosine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR00234: tyrosine--tRNA ligase" amino acids 2 to 396 (395 residues), 401.7 bits, see alignment E=2e-124 PF00579: tRNA-synt_1b" amino acids 31 to 312 (282 residues), 296.7 bits, see alignment E=1.9e-92 PF01479: S4" amino acids 338 to 372 (35 residues), 26.6 bits, see alignment 4.1e-10

Best Hits

Swiss-Prot: 100% identical to SYY_PSEPK: Tyrosine--tRNA ligase (tyrS) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 100% identity to ppf:Pput_0469)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QQ2 at UniProt or InterPro

Protein Sequence (399 amino acids)

>PP_0436 Tyrosine--tRNA ligase (Pseudomonas putida KT2440)
MKSVEEQLALIKRGAEEVLVESELVEKLKRGQPLRIKAGFDPTAPDLHLGHTVLINKLRQ
FQDLGHQVIFLIGDFTGMIGDPSGKSATRPPLTREQVLENAETYKQQVFKILDPAKTEVA
FNSTWMDKLTPADFIRLASQYTVARMLERDDFDKRYTTNQPIAIHEFLYPLVQGYDSVAL
KADVELGGTDQKFNLLMGRELQRSYGQEAQNIVTMPLLEGLDGVKKMSKSLGNYVGIQEA
PGVMYSKLVSIPDTLMWRYFELLSFRSMEEIEQFRADVANGANPRDIKIKLAEEIVARFH
GEEAAANAHRAAGNRMKEGELPEDLPEIEVAAAEDLPIAAVLNRAGLVKNSAQARDLLNS
GAVKVDGAVVDKDFMFVLGATHVCQAGKKSFGRVTLKAE