Protein Info for PP_0428 in Pseudomonas putida KT2440

Annotation: aminoacyl-adenylate hydrolase/purine nucleoside phosphoramidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 4 to 105 (102 residues), 93.6 bits, E=1.1e-30
• PF01230: HIT
  • amino acids 10 to 106 (97 residues), 101.4 bits, E=3.8e-33

Best Hits

Swiss-Prot: 59% identical to Y1390_SYNE7: Uncharacterized HIT-like protein Synpcc7942_1390 (Synpcc7942_1390) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 99% identity to pen:PSEEN0456)

MetaCyc: 49% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Sequence Analysis Tools

See Q88QR0 at UniProt or InterPro

Protein Sequence (112 amino acids)

>PP_0428 aminoacyl-adenylate hydrolase/purine nucleoside phosphoramidase (Pseudomonas putida KT2440)
MDDLFLKIINREIPADIIYEDDQILAFKDIAPAAPVHFLVIPKKHIRTLNDLTEEDKALA
GHILFTAQRLAVEQGCEEGFRVVMNCNPKGGQTVYHIHMHVLGQRQMNWPPG