Protein Info for PP_0424 in Pseudomonas putida KT2440

Annotation: DNA-binding transcriptional dual regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF00027: cNMP_binding" amino acids 22 to 114 (93 residues), 77.2 bits, see alignment E=1.1e-25 PF13545: HTH_Crp_2" amino acids 146 to 209 (64 residues), 46.3 bits, see alignment E=5.1e-16 PF00325: Crp" amino acids 170 to 200 (31 residues), 45.3 bits, see alignment 8.4e-16

Best Hits

Swiss-Prot: 82% identical to VFR_PSEAE: Cyclic AMP receptor-like protein (vfr) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10914, CRP/FNR family transcriptional regulator, cyclic AMP receptor protein (inferred from 99% identity to ppg:PputGB1_0454)

Predicted SEED Role

"Cyclic AMP receptor protein" in subsystem CytR regulation or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QR4 at UniProt or InterPro

Protein Sequence (214 amino acids)

>PP_0424 DNA-binding transcriptional dual regulator (Pseudomonas putida KT2440)
MVASALPAKIKNIDKLLVHCQRRRYTAKSNIICAGDRAETLSFIIKGSVTILIEDDDGHE
MIIAYLNHGDFFGELGLFEPVDGEQQRSAWVRAKTECEVAEISYEKFRELARQDPEILYA
LGSQMAQRLRNTTRKVGDLAFFDVTGRVARCLLELCKQPDAMTHPDGMQIKITRQEIGRI
VGCSREMVGRVLKDLEERSLVQVKGKTMVVHGTR