Protein Info for PP_0420 in Pseudomonas putida KT2440

Annotation: aminodeoxychorismate synthase / para-aminobenzoate synthase multi-enzyme complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 1 to 191 (191 residues), 287 bits, see alignment E=3.5e-90 PF00117: GATase" amino acids 3 to 191 (189 residues), 209.8 bits, see alignment E=3.1e-66 PF07722: Peptidase_C26" amino acids 71 to 175 (105 residues), 36.4 bits, see alignment E=5e-13

Best Hits

Swiss-Prot: 96% identical to TRPG_PSEPU: Anthranilate synthase component 2 (trpG) from Pseudomonas putida

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 100% identity to ppf:Pput_0453)

MetaCyc: 83% identical to anthranilate synthase beta subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27) @ Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" (EC 2.6.1.85, EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 4.1.3.27

Use Curated BLAST to search for 2.6.1.85 or 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QR8 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PP_0420 aminodeoxychorismate synthase / para-aminobenzoate synthase multi-enzyme complex (Pseudomonas putida KT2440)
MLLMIDNYDSFTYNVVQYLGELGAEVKVIRNDEMTIAQIEALNPERIVVSPGPCTPSEAG
VSIEAILHFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHGKTSPVYHRDLGVFASLNN
PLTVTRYHSLVVKRETLPDCLEVTAWTSHADGSVDEIMGLRHKTLNIEGVQFHPESILTE
QGHELFANFLKQTGGRR