Protein Info for PP_0417 in Pseudomonas putida KT2440

Annotation: Anthranilate synthase component 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 TIGR00564: anthranilate synthase component I" amino acids 26 to 484 (459 residues), 573.5 bits, see alignment E=1.9e-176 PF04715: Anth_synt_I_N" amino acids 27 to 167 (141 residues), 112.1 bits, see alignment E=2.5e-36 PF00425: Chorismate_bind" amino acids 223 to 476 (254 residues), 313.7 bits, see alignment E=1.1e-97

Best Hits

Swiss-Prot: 98% identical to TRPE_PSEPU: Anthranilate synthase component 1 (trpE) from Pseudomonas putida

KEGG orthology group: K01657, anthranilate synthase component I [EC: 4.1.3.27] (inferred from 100% identity to ppu:PP_0417)

MetaCyc: 87% identical to anthranilate synthase alpha subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

"Anthranilate synthase, aminase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QS1 at UniProt or InterPro

Protein Sequence (493 amino acids)

>PP_0417 Anthranilate synthase component 1 (Pseudomonas putida KT2440)
MNREEFLRLAAAGYNRIPLACETLADFDTPLSIYLKLADQPNSYLLESVQGGEKWGRYSM
IGLPSRTVMRVHGYRVSILHDGVEVESCEVEDPLAFVETFKDRYKVADIPGLPRFNGGLV
GYFGYDCVRYVEKRLGASPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVLVDPAEDQA
FEQGQARLQGLLETLRQPITPRRGLDLSGPQAAEPAFRSSYTREDYENAVGRIKEYILAG
DCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDNL
VTVRPIAGTRPRGATEEADRALEDDLLSDDKEIAEHLMLIDLGRNDVGRVSSTGSVRLTE
KMVIERYSNVMHIVSNVTGQLREGLTAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKR
GVYGGAVGYFAWNGNMDTAIAIRTAVIKDGELHVQAGGGIVADSVPALEWEETINKRRAM
FRAVALAEQTSAR