Protein Info for PP_0407 in Pseudomonas putida KT2440

Annotation: DnaJ-like protein DjlA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details PF27507: DjlA_TM" amino acids 1 to 36 (36 residues), 32.8 bits, see alignment 9.7e-12 PF05099: TerB" amino acids 60 to 169 (110 residues), 37.6 bits, see alignment E=3.8e-13 PF00226: DnaJ" amino acids 194 to 249 (56 residues), 29.9 bits, see alignment E=7.3e-11

Best Hits

KEGG orthology group: K05801, DnaJ like chaperone protein (inferred from 100% identity to ppf:Pput_0441)

Predicted SEED Role

"DnaJ-like protein DjlA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QT1 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PP_0407 DnaJ-like protein DjlA (Pseudomonas putida KT2440)
MWWPGTVIGVGAGFAVASIPGALLGALLGQAIDRRLRLQGWEDMRERLGGRPALRDDELL
FVMLGRLAKCDGRVAEQHIQQARQEMVRLDLAEAARLRAINAFNRGKAGKDRLGGHLRRI
SQQPHAAEGTLRACWRMVWADGKMGNKERELLLDWGQKLGMSRRQVQAMSLEYEPRKATG
AESVPMTYAAALRLLAVDADTDTDKVKQAYRRLVSRHHPDKLAGTGASEAQVREATARTR
ELHQAYAMIRKRRGL