Protein Info for PP_0398 in Pseudomonas putida KT2440

Annotation: Thiosulfate sulfurtransferase GlpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00581: Rhodanese
  • amino acids 9 to 98 (90 residues), 67.7 bits, E=5.4e-23

Best Hits

Swiss-Prot: 100% identical to GLPE_PSEPK: Thiosulfate sulfurtransferase GlpE (glpE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02439, thiosulfate sulfurtransferase [EC: 2.8.1.1] (inferred from 100% identity to ppf:Pput_0432)

MetaCyc: 50% identical to thiosulfate sulfurtransferase GlpE (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]; 2.8.1.- [EC: 2.8.1.1]

Predicted SEED Role

"Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 2.8.1.1)

MetaCyc Pathways

• thiosulfate disproportionation IV (rhodanese) (1/1 steps found)
• sulfide oxidation IV (mitochondria) (2/5 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

See Q88QT9 at UniProt or InterPro

Protein Sequence (110 amino acids)

>PP_0398 Thiosulfate sulfurtransferase GlpE (Pseudomonas putida KT2440)
MSEFKRIPPEQALELRKKEGAVVVDIRDPQAFAAGHITGARHLDNHSVADFIRNADLDAP
TLVVCYHGNSSQSAAAYLVGQGFSDVYSVDGGFELWRATYPAETAQGNAE