Protein Info for PP_0376 in Pseudomonas putida KT2440

Annotation: Coenzyme PQQ synthesis protein E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 6 to 366 (361 residues), 609.4 bits, see alignment E=1.9e-187 PF04055: Radical_SAM" amino acids 17 to 173 (157 residues), 92.8 bits, see alignment E=4.2e-30 PF13353: Fer4_12" amino acids 20 to 101 (82 residues), 27.1 bits, see alignment E=6.8e-10 PF13186: SPASM" amino acids 244 to 309 (66 residues), 32.8 bits, see alignment E=1.1e-11 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 251 to 336 (86 residues), 29.5 bits, see alignment E=8.1e-11

Best Hits

Swiss-Prot: 100% identical to PQQE_PSEPK: PqqA peptide cyclase (pqqE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 100% identity to ppf:Pput_0401)

MetaCyc: 70% identical to glutamate Cgamma--tyrosine C3 ligase (Klebsiella pneumoniae)
RXN-11176 [EC: 1.21.98.4]

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.21.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QV8 at UniProt or InterPro

Protein Sequence (376 amino acids)

>PP_0376 Coenzyme PQQ synthesis protein E (Pseudomonas putida KT2440)
MPPTPEVGLPLWLLAELTYRCPLQCPYCSNPLDFAAQGQELSTEQWFKVMAEAREMGAAQ
IGFSGGEPLVRQDLAQLIAEARRLGYYTNLITSGIGLTEARIADFKKAGLDHIQISFQAS
DEQVNNLLAGSKKAFAQKLEMARAVKAHGYPMVLNFVTHRHNIDKIDRIIELCIALEADF
VELATCQFYGWAHLNRLGLLPTRAQLERAERITNEYRDKLKAEGNPCKLIFVTPDYYEER
PKACMNGWGNLFLTITPDGTALPCHGARQLPVQFPNVRDHDLHHIWYESFGFNRFRGYEW
MREPCRSCDEKEKDFGGCRCQAFMLTGDASNADPVCAKSTDHGIILKAREEAETAQLAIE
QMTFRNDRNSRVIARG