Protein Info for PP_0375 in Pseudomonas putida KT2440

Annotation: Prolyl oligopeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 PF20434: BD-FAE" amino acids 373 to 564 (192 residues), 40.1 bits, see alignment E=6.2e-14 PF00326: Peptidase_S9" amino acids 401 to 607 (207 residues), 165.8 bits, see alignment E=2e-52 PF01738: DLH" amino acids 416 to 589 (174 residues), 32.9 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0375)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QV9 at UniProt or InterPro

Protein Sequence (612 amino acids)

>PP_0375 Prolyl oligopeptidase family protein (Pseudomonas putida KT2440)
MIETPVSSPAAEFSAAQAVAAGTDFAELKVSADGLFWNEFRPADGACRIWHWLHYQARCL
TPDGFSVRSRVYEYGGGSFCLGGDGLVFVNEKDQQVYTQPLDNLLPRALTQDASCRYGDV
QWHDGQVLAVEERHAEQVEHRLVALGDSRREVLAEGADFYASPTVSADGQRLAWIEWDRP
AQPWTVTRLVCRVRDASGHWGPAQCVAAAEESLQQPRFDAEGRLYCLSDRNGFWQPWGEV
DGQWQPLPAAPADHAAAPWQLGTCTWLALGPQSYLASWFKDGFGQLGLRGEDGRMERFAS
AYTRFRSLAMDSEHLYAIAASPISPPAVIAIDRGNHEVRVLAGGAEILPAGQISLPQPIH
YGSGGEQAHGFFYPPAQPQGAAPLVVFIHGGPTSACYPVLDPRIQYWTQRGFAVADLNYR
GSTGYGREYRQALHLRWGESDVADACAAVEYLAAQGLVDKHKAFIRGGSAGGYTTLCALA
FHDVFRAGASLYGVSDPIALGRATHKFEGDYLDWLIGDPQRDAERYRQRTPLLHADSIRA
PVIFFQGELDAVVVPEQTRKMLAALKAKGVQAEAHFYALERHGFRQANNLAHALEQEWLF
FCNVINHQHNKN